Lineage for d5wuxb2 (5wux B:107-212)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (15 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (876 PDB entries)
  8. 2353692Domain d5wuxb2: 5wux B:107-212 [344433]
    Other proteins in same PDB: d5wuxb1, d5wuxd1, d5wuxe_, d5wuxf_, d5wuxg_, d5wuxl1
    automated match to d1dn0a2

Details for d5wuxb2

PDB Entry: 5wux (more details), 2.9 Å

PDB Description: tnfalpha-certolizumab fab
PDB Compounds: (B:) light

SCOPe Domain Sequences for d5wuxb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wuxb2 b.1.1.2 (B:107-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

SCOPe Domain Coordinates for d5wuxb2:

Click to download the PDB-style file with coordinates for d5wuxb2.
(The format of our PDB-style files is described here.)

Timeline for d5wuxb2:

  • d5wuxb2 is new in SCOPe 2.07-stable