Lineage for d5wuxl1 (5wux L:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (25 species)
    not a true protein
  7. 2355363Species Human (Homo sapiens) [TaxId:9606] [187920] (1170 PDB entries)
  8. 2357460Domain d5wuxl1: 5wux L:1-106 [344436]
    Other proteins in same PDB: d5wuxb2, d5wuxd2, d5wuxe_, d5wuxf_, d5wuxg_, d5wuxl2
    automated match to d1dn0a1

Details for d5wuxl1

PDB Entry: 5wux (more details), 2.9 Å

PDB Description: tnfalpha-certolizumab fab
PDB Compounds: (L:) light

SCOPe Domain Sequences for d5wuxl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wuxl1 b.1.1.0 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitckasqnvgtnvawyqqkpgkapkaliysasflysgvpy
rfsgsgsgtdftltisslqpedfatyycqqyniypltfgqgtkvei

SCOPe Domain Coordinates for d5wuxl1:

Click to download the PDB-style file with coordinates for d5wuxl1.
(The format of our PDB-style files is described here.)

Timeline for d5wuxl1:

  • d5wuxl1 is new in SCOPe 2.07-stable