SCOPe 2.08: Domain d5wuxl2: 5wux L:107-213

Lineage for d5wuxl2 (5wux L:107-213)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
Domain d5wuxl2: 5wux L:107-213 [344437]
Other proteins in same PDB: d5wuxa_, d5wuxb1, d5wuxc_, d5wuxd1, d5wuxe_, d5wuxf_, d5wuxg_, d5wuxh_, d5wuxl1
automated match to d1dn0a2

Details for d5wuxl2

PDB Entry: 5wux (more details), 2.9 Å

PDB Description: tnfalpha-certolizumab fab

PDB Compounds: (L:) light

SCOPe Domain Sequences for d5wuxl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wuxl2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOPe Domain Coordinates for d5wuxl2:

Click to download the PDB-style file with coordinates for d5wuxl2.
(The format of our PDB-style files is described here.)

Timeline for d5wuxl2: