![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5wuxd2: 5wux D:107-208 [344435] Other proteins in same PDB: d5wuxa_, d5wuxb1, d5wuxc_, d5wuxd1, d5wuxe_, d5wuxf_, d5wuxg_, d5wuxh_, d5wuxl1 automated match to d1dn0a2 |
PDB Entry: 5wux (more details), 2.9 Å
SCOPe Domain Sequences for d5wuxd2:
Sequence, based on SEQRES records: (download)
>d5wuxd2 b.1.1.2 (D:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq dskdstyslsstltlskadyekhkvyacevthqglsspvtks
>d5wuxd2 b.1.1.2 (D:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]} krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvlqsgnsqesvteqdskdsty slsstltlskadyekhkvyacevthqglsspvtks
Timeline for d5wuxd2: