SCOPe 2.08: Domain d5wuxd2: 5wux D:107-208

Lineage for d5wuxd2 (5wux D:107-208)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5wuxd2: 5wux D:107-208 [344435]
   Other proteins in same PDB: d5wuxa_, d5wuxb1, d5wuxc_, d5wuxd1, d5wuxe_, d5wuxf_, d5wuxg_, d5wuxh_, d5wuxl1
   automated match to d1dn0a2

Details for d5wuxd2

PDB Entry: 5wux, 2.9 Å

PDB Description: tnfalpha-certolizumab fab

PDB Compounds: (D:) light

SCOPe Domain Sequences for d5wuxd2:

Sequence, based on SEQRES records:

>d5wuxd2 b.1.1.2 (D:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtks

Sequence, based on observed residues (ATOM records):

>d5wuxd2 b.1.1.2 (D:107-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvlqsgnsqesvteqdskdsty
slsstltlskadyekhkvyacevthqglsspvtks

Timeline for d5wuxd2:

• d5wuxd2 first appeared in SCOPe 2.07