SCOPe 2.08: Domain d7dz8f_: 7dz8 F:

Lineage for d7dz8f_ (7dz8 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.16: Subunit III of photosystem I reaction centre, PsaF [81536] (2 families)
   automatically mapped to Pfam PF02507

5. Family f.23.16.0: automated matches [276195] (1 protein)
   not a true family

6. Protein automated matches [276199] (5 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370452] (7 PDB entries)

8. Domain d7dz8f_: 7dz8 F: [405135]
   Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8c_, d7dz8d_, d7dz8e_, d7dz8j_, d7dz8u_, d7dz8v_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_
   automated match to d5l8rf_
   complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz8f_

PDB Entry: 7dz8, 3.16 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii

PDB Compounds: (F:) photosystem I reaction center subunit III, chloroplastic

SCOPe Domain Sequences for d7dz8f_:

Sequence; same for both SEQRES and ATOM records:

>d7dz8f_ f.23.16.0 (F:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
diagltpcseskayaklekkelktlekrlkqyeadsapavalkatmertkarfanyakag
llcgndglphliadpglalkyghagevfiptfgflyvagyigyvgrqyliavkgeakptd
keiiidvplatklawqgagwplaavqelqrgtllekeenitvspr

Timeline for d7dz8f_:

• d7dz8f_ first appeared in SCOPe 2.07