Lineage for d7dz8e_ (7dz8 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2783741Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 2783857Family b.34.4.0: automated matches [191659] (1 protein)
    not a true family
  6. 2783858Protein automated matches [191237] (8 species)
    not a true protein
  7. 2783899Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370429] (7 PDB entries)
  8. 2783901Domain d7dz8e_: 7dz8 E: [405122]
    Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8c_, d7dz8d_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8v_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_
    automated match to d4y28e_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz8e_

PDB Entry: 7dz8 (more details), 3.16 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii
PDB Compounds: (E:) Photosystem I reaction center subunit IV, chloroplastic

SCOPe Domain Sequences for d7dz8e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz8e_ b.34.4.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
evgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyaldev
vaa

SCOPe Domain Coordinates for d7dz8e_:

Click to download the PDB-style file with coordinates for d7dz8e_.
(The format of our PDB-style files is described here.)

Timeline for d7dz8e_: