Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) |
Family b.34.4.0: automated matches [191659] (1 protein) not a true family |
Protein automated matches [191237] (8 species) not a true protein |
Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370429] (7 PDB entries) |
Domain d7dz8e_: 7dz8 E: [405122] Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8c_, d7dz8d_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8v_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_ automated match to d4y28e_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz8 (more details), 3.16 Å
SCOPe Domain Sequences for d7dz8e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz8e_ b.34.4.0 (E:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} evgpkrgslvkilrpesywfnqvgkvvsvdqsgvrypvvvrfenqnyagvttnnyaldev vaa
Timeline for d7dz8e_: