SCOPe 2.08: Domain d7dz8v_: 7dz8 V:

Lineage for d7dz8v_ (7dz8 V:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
   membrane all-alpha fold; three transmembrane helices

4. Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families)
   duplication: contains two structural repeats

5. Family f.43.1.0: automated matches [276197] (1 protein)
   not a true family

6. Protein automated matches [276200] (4 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries)

8. Domain d7dz8v_: 7dz8 V: [405097]
   Other proteins in same PDB: d7dz8b_, d7dz8c_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_
   automated match to d5xnls_
   complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz8v_

PDB Entry: 7dz8, 3.16 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii

PDB Compounds: (V:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d7dz8v_:

Sequence; same for both SEQRES and ATOM records:

>d7dz8v_ f.43.1.0 (V:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
kktirekagwwsnggneklsafygpdrglwlgplsgttpayltgefpgdygwdsaglsad
petfkryreleliharwamlgalgcitpellakngtpivepvwfkagaqifaeggldylg
npglvhaqsilatlavqvilmgaiegyrvnggpagegldklhpggqffdplglaedpdaf
aelkvkeikngrlamfsmfgffvqaivtgkgplanldehlaspftsnaftyaqkftpq

Timeline for d7dz8v_:

• d7dz8v_ first appeared in SCOPe 2.07