Lineage for d7dz89_ (7dz8 9:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028445Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370435] (9 PDB entries)
  8. 3028460Domain d7dz89_: 7dz8 9: [405098]
    Other proteins in same PDB: d7dz8b_, d7dz8c_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_
    automated match to d5l8r4_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz89_

PDB Entry: 7dz8 (more details), 3.16 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii
PDB Compounds: (9:) Chlorophyll a-b binding protein, chloroplastic

SCOPe Domain Sequences for d7dz89_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz89_ f.43.1.0 (9:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
rptwlpglnppahlkgalagdngfdplglgqdegrlkwyaeaektngrwammavagilgq
ellgvtpawweagakeydipaqaltpiefivmgfleikryqgfkqtgtsgfinsfpfdpa
gmnspsmatkevkngrlamvafigfcvqalatrtqpiegltahladpfgknityylthlp
etl

SCOPe Domain Coordinates for d7dz89_:

Click to download the PDB-style file with coordinates for d7dz89_.
(The format of our PDB-style files is described here.)

Timeline for d7dz89_: