SCOPe 2.08: Domain d7dz8c_: 7dz8 C:

Lineage for d7dz8c_ (7dz8 C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
   has C-terminal extension to the common fold

6. Protein automated matches [236563] (10 species)
   not a true protein

7. Species Green alga (Chlamydomonas reinhardtii) [TaxId:3055] [370446] (5 PDB entries)

8. Domain d7dz8c_: 7dz8 C: [405052]
   Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8v_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_
   automated match to d4kt0c_
   complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz8c_

PDB Entry: 7dz8, 3.16 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii

PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d7dz8c_:

Sequence; same for both SEQRES and ATOM records:

>d7dz8c_ d.58.1.2 (C:) automated matches {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]}
ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd
flsvrvylgsestrsmglsy

Timeline for d7dz8c_:

• d7dz8c_ first appeared in SCOPe 2.07