![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) ![]() |
![]() | Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
![]() | Protein automated matches [236563] (6 species) not a true protein |
![]() | Species Chlamydomonas reinhardtii [TaxId:3055] [370446] (4 PDB entries) |
![]() | Domain d7dz8c_: 7dz8 C: [405052] Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8v_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_ automated match to d4kt0c_ complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant |
PDB Entry: 7dz8 (more details), 3.16 Å
SCOPe Domain Sequences for d7dz8c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7dz8c_ d.58.1.2 (C:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd flsvrvylgsestrsmglsy
Timeline for d7dz8c_: