Lineage for d7dz8c_ (7dz8 C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2555964Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins)
    has C-terminal extension to the common fold
  6. 2556026Protein automated matches [236563] (6 species)
    not a true protein
  7. 2556029Species Chlamydomonas reinhardtii [TaxId:3055] [370446] (4 PDB entries)
  8. 2556031Domain d7dz8c_: 7dz8 C: [405052]
    Other proteins in same PDB: d7dz81_, d7dz83_, d7dz84_, d7dz87_, d7dz88_, d7dz89_, d7dz8a_, d7dz8b_, d7dz8d_, d7dz8e_, d7dz8f_, d7dz8j_, d7dz8u_, d7dz8v_, d7dz8w_, d7dz8x_, d7dz8y_, d7dz8z_
    automated match to d4kt0c_
    complexed with bcr, chl, cla, dgd, lhg, lmg, lmu, lut, nex, pqn, sf4, tpo, xat; mutant

Details for d7dz8c_

PDB Entry: 7dz8 (more details), 3.16 Å

PDB Description: state transition supercomplex psi-lhci-lhcii from the lhcbm1 lacking mutant of chlamydomonas reinhardtii
PDB Compounds: (C:) photosystem I iron-sulfur center

SCOPe Domain Sequences for d7dz8c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7dz8c_ d.58.1.2 (C:) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
ahivkiydtcigctqcvracpldvlemvpwdgckasqmasaprtedcvgckrcetacptd
flsvrvylgsestrsmglsy

SCOPe Domain Coordinates for d7dz8c_:

Click to download the PDB-style file with coordinates for d7dz8c_.
(The format of our PDB-style files is described here.)

Timeline for d7dz8c_: