SCOPe 2.08: Domain d7khvf2: 7khv F:496-624

Lineage for d7khvf2 (7khv F:496-624)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
   5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology

4. Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families)

5. Family a.246.1.0: automated matches [254242] (1 protein)
   not a true family

6. Protein automated matches [254554] (3 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [255691] (3 PDB entries)

8. Domain d7khvf2: 7khv F:496-624 [395042]
   Other proteins in same PDB: d7khva1, d7khva2, d7khvb1, d7khvb2, d7khvc1, d7khvc2, d7khvd1, d7khvd2, d7khve1, d7khve2, d7khvf1
   automated match to d2v5ca3
   complexed with ca, cl, so4, x1a

Details for d7khvf2

PDB Entry: 7khv, 2.3 Å

PDB Description: cpoga in complex with ligand 54

PDB Compounds: (F:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d7khvf2:

Sequence; same for both SEQRES and ATOM records:

>d7khvf2 a.246.1.0 (F:496-624) automated matches {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

Timeline for d7khvf2:

• d7khvf2 first appeared in SCOPe 2.07