Lineage for d7khva3 (7khv A:496-624)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738194Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2738195Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2738227Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 2738228Protein automated matches [254554] (3 species)
    not a true protein
  7. 2738235Species Clostridium perfringens [TaxId:1502] [255691] (3 PDB entries)
  8. 2738238Domain d7khva3: 7khv A:496-624 [394972]
    Other proteins in same PDB: d7khva1, d7khva2, d7khvb1, d7khvb2, d7khvc1, d7khvc2, d7khvd1, d7khvd2, d7khve1, d7khve2, d7khvf1
    automated match to d2v5ca3
    complexed with ca, cl, so4, x1a

Details for d7khva3

PDB Entry: 7khv (more details), 2.3 Å

PDB Description: cpoga in complex with ligand 54
PDB Compounds: (A:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d7khva3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7khva3 a.246.1.0 (A:496-624) automated matches {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOPe Domain Coordinates for d7khva3:

Click to download the PDB-style file with coordinates for d7khva3.
(The format of our PDB-style files is described here.)

Timeline for d7khva3: