PDB entry 7khv

View 7khv on RCSB PDB site
Description: CpOGA IN COMPLEX WITH LIGAND 54
Class: hydrolase/inhibitor
Keywords: GLYCOSIDE HYDROLASE, INHIBITOR, HYDROLASE, HYDROLASE-INHIBITOR complex
Deposited on 2020-10-22, released 2020-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-12-02, with a file datestamp of 2020-11-27.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Gene: nagJ, CPF_1442
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • engineered mutation (267)
      • engineered mutation (300)
      • engineered mutation (357)
    Domains in SCOPe 2.08: d7khva1, d7khva2, d7khva3
  • Chain 'B':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Gene: nagJ, CPF_1442
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • engineered mutation (267)
      • engineered mutation (300)
      • engineered mutation (357)
    Domains in SCOPe 2.08: d7khvb1, d7khvb2, d7khvb3
  • Chain 'C':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Gene: nagJ, CPF_1442
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • engineered mutation (267)
      • engineered mutation (300)
      • engineered mutation (357)
    Domains in SCOPe 2.08: d7khvc1, d7khvc2, d7khvc3
  • Chain 'D':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Gene: nagJ, CPF_1442
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • engineered mutation (267)
      • engineered mutation (300)
      • engineered mutation (357)
    Domains in SCOPe 2.08: d7khvd1, d7khvd2, d7khvd3
  • Chain 'E':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Gene: nagJ, CPF_1442
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • engineered mutation (267)
      • engineered mutation (300)
      • engineered mutation (357)
    Domains in SCOPe 2.08: d7khve1, d7khve2, d7khve3
  • Chain 'F':
    Compound: O-GlcNAcase nagJ
    Species: Clostridium perfringens [TaxId:1502]
    Gene: nagJ, CPF_1442
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0TR53 (Start-593)
      • engineered mutation (267)
      • engineered mutation (300)
      • engineered mutation (357)
    Domains in SCOPe 2.08: d7khvf1, d7khvf2
  • Heterogens: X1A, CA, SO4, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >7khvA (A:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplit
    cpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >7khvA (A:)
    nqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsend
    pnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqt
    fkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapk
    ddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhli
    tkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplitcpteydtg
    amvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrnmavwwnyp
    vtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydk
    awnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskeda
    salieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlne
    dteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >7khvB (B:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplit
    cpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >7khvB (B:)
    qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
    nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
    kqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkd
    dpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlit
    kaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplitcpteydtga
    mvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypv
    tdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydka
    wnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedas
    alieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlned
    teayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >7khvC (C:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplit
    cpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >7khvC (C:)
    qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
    nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
    kqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkd
    dpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlit
    kaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplitcpteydtga
    mvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypv
    tdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydka
    wnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedas
    alieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlned
    teayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >7khvD (D:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplit
    cpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >7khvD (D:)
    qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
    nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
    kqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapkd
    dpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhlit
    kaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplitcpteydtga
    mvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrnmavwwnypv
    tdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydka
    wnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskedas
    alieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlned
    teayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >7khvE (E:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplit
    cpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >7khvE (E:)
    nqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsend
    pnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqt
    fkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenklntyiyapk
    ddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdageedfnhli
    tkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplitcpteydtg
    amvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrnmavwwnyp
    vtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswnmdnydydk
    awnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwnklsskeda
    salieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasldmivaqlne
    dteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >7khvF (F:)
    vgpktgeenqvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltann
    ieinsendpnsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgd
    gtfygvqtfkqlvkesnipevnitdyptvsargivegfygtpwthqdrldqikfygenkl
    ntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirfdgdag
    eedfnhlitkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdvkplit
    cpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisgiydrn
    mavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaadyswn
    mdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakmdelwn
    klsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgdkasld
    mivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli
    

    Sequence, based on observed residues (ATOM records): (download)
    >7khvF (F:)
    vpnlnptpenlevvggeeeadenavnalrefltannieinsendpgevdtaenlkeegya
    liegkdgdgtfygvqtfkqlvkesevnitdyptvsargivegfygtpwthqdrldqikfy
    genklntyiyapkddpyhrekwrepypesemqrmqelinasaenkvdfvfgispgidirf
    dgdageedfnhlitkaeslydmgvrsfaiywdniqdksaakhaqvlnrfneefvkakgdv
    kplitcpteydtgamvsngqpraytrifaetvdpsievmwtgpgvvtneiplsdaqlisg
    iydrnmavwwnypvtdyfkgklalgpmhgldkglnqyvdfftvnpmehaelskisihtaa
    dyswnmdnydydkawnraidmlygdlaedmkvfanhstrmdnktwaksgredapelrakm
    delwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrqldelitlaqgd
    kasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqealsfdltli