Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) contains similar fold but lacks its catalytic centre |
Family d.92.2.0: automated matches [227269] (1 protein) not a true family |
Protein automated matches [227062] (5 species) not a true protein |
Species Clostridium perfringens [TaxId:1502] [255689] (3 PDB entries) |
Domain d7khvd1: 7khv D:40-178 [395058] Other proteins in same PDB: d7khva2, d7khva3, d7khvb2, d7khvb3, d7khvc2, d7khvc3, d7khvd2, d7khvd3, d7khve2, d7khve3, d7khvf1, d7khvf2 automated match to d2v5ca1 complexed with ca, cl, so4, x1a |
PDB Entry: 7khv (more details), 2.3 Å
SCOPe Domain Sequences for d7khvd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d7khvd1 d.92.2.0 (D:40-178) automated matches {Clostridium perfringens [TaxId: 1502]} qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf kqlvkesnipevnitdypt
Timeline for d7khvd1: