Lineage for d7khvd1 (7khv D:40-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2965096Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2965198Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2965199Protein automated matches [227062] (5 species)
    not a true protein
  7. 2965206Species Clostridium perfringens [TaxId:1502] [255689] (3 PDB entries)
  8. 2965212Domain d7khvd1: 7khv D:40-178 [395058]
    Other proteins in same PDB: d7khva2, d7khva3, d7khvb2, d7khvb3, d7khvc2, d7khvc3, d7khvd2, d7khvd3, d7khve2, d7khve3, d7khvf1, d7khvf2
    automated match to d2v5ca1
    complexed with ca, cl, so4, x1a

Details for d7khvd1

PDB Entry: 7khv (more details), 2.3 Å

PDB Description: cpoga in complex with ligand 54
PDB Compounds: (D:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d7khvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7khvd1 d.92.2.0 (D:40-178) automated matches {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

SCOPe Domain Coordinates for d7khvd1:

Click to download the PDB-style file with coordinates for d7khvd1.
(The format of our PDB-style files is described here.)

Timeline for d7khvd1: