SCOPe 2.08: Domain d7khvc1: 7khv C:40-178

Lineage for d7khvc1 (7khv C:40-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families)
   contains similar fold but lacks its catalytic centre

5. Family d.92.2.0: automated matches [227269] (1 protein)
   not a true family

6. Protein automated matches [227062] (5 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [255689] (3 PDB entries)

8. Domain d7khvc1: 7khv C:40-178 [395007]
   Other proteins in same PDB: d7khva2, d7khva3, d7khvb2, d7khvb3, d7khvc2, d7khvc3, d7khvd2, d7khvd3, d7khve2, d7khve3, d7khvf1, d7khvf2
   automated match to d2v5ca1
   complexed with ca, cl, so4, x1a

Details for d7khvc1

PDB Entry: 7khv, 2.3 Å

PDB Description: cpoga in complex with ligand 54

PDB Compounds: (C:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d7khvc1:

Sequence; same for both SEQRES and ATOM records:

>d7khvc1 d.92.2.0 (C:40-178) automated matches {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

Timeline for d7khvc1:

• d7khvc1 first appeared in SCOPe 2.07