![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies) 5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology |
![]() | Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) ![]() |
![]() | Family a.246.1.0: automated matches [254242] (1 protein) not a true family |
![]() | Protein automated matches [254554] (3 species) not a true protein |
![]() | Species Clostridium perfringens [TaxId:1502] [255691] (3 PDB entries) |
![]() | Domain d7khvc3: 7khv C:496-624 [395009] Other proteins in same PDB: d7khva1, d7khva2, d7khvb1, d7khvb2, d7khvc1, d7khvc2, d7khvd1, d7khvd2, d7khve1, d7khve2, d7khvf1 automated match to d2v5ca3 complexed with ca, cl, so4, x1a |
PDB Entry: 7khv (more details), 2.3 Å
SCOPe Domain Sequences for d7khvc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d7khvc3 a.246.1.0 (C:496-624) automated matches {Clostridium perfringens [TaxId: 1502]} edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe alsfdltli
Timeline for d7khvc3: