SCOPe 2.07: Domain d6w9vg2: 6w9v G:111-202

Lineage for d6w9vg2 (6w9v G:111-202)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d6w9vg2: 6w9v G:111-202 [392893]
   Other proteins in same PDB: d6w9va1, d6w9va2, d6w9va3, d6w9vb1, d6w9vb2, d6w9vc1, d6w9vc2, d6w9vc3, d6w9vd1, d6w9ve1, d6w9ve2, d6w9vf1, d6w9vf2, d6w9vg1, d6w9vh1, d6w9vh2
   automated match to d2f54d2
   complexed with act, gol

Details for d6w9vg2

PDB Entry: 6w9v, 1.95 Å

PDB Description: structure of human mait a-f7 tcr in complex with patient mr1-r9h without ligand

PDB Compounds: (G:) TCR-alpha chain

SCOPe Domain Sequences for d6w9vg2:

Sequence; same for both SEQRES and ATOM records:

>d6w9vg2 b.1.1.2 (G:111-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspes

Timeline for d6w9vg2:

• d6w9vg2 is new in SCOPe 2.07-stable
  
• d6w9vg2 appears in the current release, SCOPe 2.08