Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d6w9vg2: 6w9v G:111-202 [392893] Other proteins in same PDB: d6w9va1, d6w9va2, d6w9va3, d6w9vb1, d6w9vb2, d6w9vc1, d6w9vc2, d6w9vc3, d6w9vd1, d6w9ve1, d6w9ve2, d6w9vf1, d6w9vf2, d6w9vg1, d6w9vh1, d6w9vh2 automated match to d2f54d2 complexed with act, gol |
PDB Entry: 6w9v (more details), 1.95 Å
SCOPe Domain Sequences for d6w9vg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9vg2 b.1.1.2 (G:111-202) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpspes
Timeline for d6w9vg2: