Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries) |
Domain d6w9va1: 6w9v A:1-178 [392916] Other proteins in same PDB: d6w9va2, d6w9va3, d6w9vb1, d6w9vb2, d6w9vc2, d6w9vc3, d6w9vd1, d6w9vd2, d6w9ve1, d6w9ve2, d6w9vf1, d6w9vf2, d6w9vg1, d6w9vg2, d6w9vh1, d6w9vh2 automated match to d4l4va1 complexed with act, gol |
PDB Entry: 6w9v (more details), 1.95 Å
SCOPe Domain Sequences for d6w9va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6w9va1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfhlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6w9va1: