Lineage for d6w9vc1 (6w9v C:1-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2545715Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2545716Protein automated matches [226842] (5 species)
    not a true protein
  7. 2545737Species Human (Homo sapiens) [TaxId:9606] [226044] (102 PDB entries)
  8. 2545756Domain d6w9vc1: 6w9v C:1-178 [392934]
    Other proteins in same PDB: d6w9va2, d6w9va3, d6w9vb1, d6w9vb2, d6w9vc2, d6w9vc3, d6w9vd1, d6w9vd2, d6w9ve1, d6w9ve2, d6w9vf1, d6w9vf2, d6w9vg1, d6w9vg2, d6w9vh1, d6w9vh2
    automated match to d4l4va1
    complexed with act, gol

Details for d6w9vc1

PDB Entry: 6w9v (more details), 1.95 Å

PDB Description: structure of human mait a-f7 tcr in complex with patient mr1-r9h without ligand
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6w9vc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w9vc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfhlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d6w9vc1:

Click to download the PDB-style file with coordinates for d6w9vc1.
(The format of our PDB-style files is described here.)

Timeline for d6w9vc1: