Lineage for d6w9vd1 (6w9v D:2-110)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2366137Domain d6w9vd1: 6w9v D:2-110 [392885]
    Other proteins in same PDB: d6w9va1, d6w9va3, d6w9vb1, d6w9vb2, d6w9vc1, d6w9vc3, d6w9vd2, d6w9vf1, d6w9vf2, d6w9vg2
    automated match to d2f54d1
    complexed with act, gol

Details for d6w9vd1

PDB Entry: 6w9v (more details), 1.95 Å

PDB Description: structure of human mait a-f7 tcr in complex with patient mr1-r9h without ligand
PDB Compounds: (D:) TCR-alpha chain

SCOPe Domain Sequences for d6w9vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w9vd1 b.1.1.0 (D:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d6w9vd1:

Click to download the PDB-style file with coordinates for d6w9vd1.
(The format of our PDB-style files is described here.)

Timeline for d6w9vd1: