Lineage for d6w9vd2 (6w9v D:111-198)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2361513Domain d6w9vd2: 6w9v D:111-198 [392886]
    Other proteins in same PDB: d6w9va1, d6w9va2, d6w9va3, d6w9vb1, d6w9vb2, d6w9vc1, d6w9vc2, d6w9vc3, d6w9vd1, d6w9ve1, d6w9ve2, d6w9vf1, d6w9vf2, d6w9vg1, d6w9vh1, d6w9vh2
    automated match to d2f54d2
    complexed with act, gol

Details for d6w9vd2

PDB Entry: 6w9v (more details), 1.95 Å

PDB Description: structure of human mait a-f7 tcr in complex with patient mr1-r9h without ligand
PDB Compounds: (D:) TCR-alpha chain

SCOPe Domain Sequences for d6w9vd2:

Sequence, based on SEQRES records: (download)

>d6w9vd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

Sequence, based on observed residues (ATOM records): (download)

>d6w9vd2 b.1.1.2 (D:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsn
facanafnnsiipedtffp

SCOPe Domain Coordinates for d6w9vd2:

Click to download the PDB-style file with coordinates for d6w9vd2.
(The format of our PDB-style files is described here.)

Timeline for d6w9vd2: