SCOPe 2.07: Domain d2f54d2: 2f54 D:115-205

Lineage for d2f54d2 (2f54 D:115-205)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
Domain d2f54d2: 2f54 D:115-205 [145143]
Other proteins in same PDB: d2f54a1, d2f54a2, d2f54b2, d2f54b3, d2f54d1, d2f54e1, d2f54f1, d2f54f2, d2f54g2, d2f54g3, d2f54k1, d2f54l1

Details for d2f54d2

PDB Entry: 2f54 (more details), 2.7 Å

PDB Description: directed evolution of human t cell receptor cdr2 residues by phage display dramatically enhances affinity for cognate peptide-mhc without increasing apparent cross-reactivity

PDB Compounds: (D:) T-cell receptor alpha chain

SCOPe Domain Sequences for d2f54d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f54d2 b.1.1.2 (D:115-205) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe

SCOPe Domain Coordinates for d2f54d2:

Click to download the PDB-style file with coordinates for d2f54d2.
(The format of our PDB-style files is described here.)

Timeline for d2f54d2: