Lineage for d6obhb2 (6obh B:148-221)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706557Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 2706558Protein automated matches [191156] (12 species)
    not a true protein
  7. 2706577Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)
  8. 2706621Domain d6obhb2: 6obh B:148-221 [373458]
    Other proteins in same PDB: d6obha1, d6obhb1, d6obhc1, d6obhd1, d6obhe1, d6obhf1
    automated match to d2m8pa2
    complexed with na

Details for d6obhb2

PDB Entry: 6obh (more details), 2.96 Å

PDB Description: structure of hiv-1 ca 1/2-hexamer
PDB Compounds: (B:) ca

SCOPe Domain Sequences for d6obhb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6obhb2 a.28.3.0 (B:148-221) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqgv

SCOPe Domain Coordinates for d6obhb2:

Click to download the PDB-style file with coordinates for d6obhb2.
(The format of our PDB-style files is described here.)

Timeline for d6obhb2: