Lineage for d2m8pa2 (2m8p A:148-221)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-downSuperfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) 
Family a.28.3.0: automated matches [191629] (1 protein)
not a true familyProtein automated matches [191156] (12 species)
not a true protein
Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries) 
Domain d2m8pa2: 2m8p A:148-221 [243147]
Other proteins in same PDB: d2m8pa1
automated match to d3ntea2
mutant
Details for d2m8pa2
PDB Entry: 2m8p (more details)
PDB Description: the structure of the w184am185a mutant of the hiv-1 capsid protein
PDB Compounds: (A:) capsid protein p24SCOPe Domain Sequences for d2m8pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2m8pa2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqgv
SCOPe Domain Coordinates for d2m8pa2:
Click to download the PDB-style file with coordinates for d2m8pa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2m8pa2:
- d2m8pa2 first appeared in SCOPe 2.04
- d2m8pa2 appears in SCOPe 2.07
View in 3D
