SCOPe 2.08: Domain d2m8pa1: 2m8p A:1-147

Lineage for d2m8pa1 (2m8p A:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d2m8pa1: 2m8p A:1-147 [243146]
   Other proteins in same PDB: d2m8pa2
   automated match to d3ntea1
   mutant

Details for d2m8pa1

PDB Entry: 2m8p

PDB Description: the structure of the w184am185a mutant of the hiv-1 capsid protein

PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2m8pa1:

Sequence; same for both SEQRES and ATOM records:

>d2m8pa1 a.73.1.1 (A:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Timeline for d2m8pa1:

• d2m8pa1 first appeared in SCOPe 2.04
  
• d2m8pa1 appears in SCOPe 2.07