Lineage for d2m8pa2 (2m8p A:148-221)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487668Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1487669Protein automated matches [191156] (6 species)
    not a true protein
  7. 1487709Species Human immunodeficiency virus type 1 [TaxId:11698] [232917] (4 PDB entries)
  8. 1487714Domain d2m8pa2: 2m8p A:148-221 [243147]
    Other proteins in same PDB: d2m8pa1
    automated match to d3ntea2
    mutant

Details for d2m8pa2

PDB Entry: 2m8p (more details)

PDB Description: the structure of the w184am185a mutant of the hiv-1 capsid protein
PDB Compounds: (A:) capsid protein p24

SCOPe Domain Sequences for d2m8pa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m8pa2 a.28.3.0 (A:148-221) automated matches {Human immunodeficiency virus type 1 [TaxId: 11698]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacqgv

SCOPe Domain Coordinates for d2m8pa2:

Click to download the PDB-style file with coordinates for d2m8pa2.
(The format of our PDB-style files is described here.)

Timeline for d2m8pa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m8pa1