SCOPe 2.08: Domain d6obhe1: 6obh E:1-147

Lineage for d6obhe1 (6obh E:1-147)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d6obhe1: 6obh E:1-147 [373478]
   Other proteins in same PDB: d6obha2, d6obhb2, d6obhc2, d6obhd2, d6obhe2, d6obhf2
   automated match to d4xfxa1
   complexed with na

Details for d6obhe1

PDB Entry: 6obh, 2.96 Å

PDB Description: structure of hiv-1 ca 1/2-hexamer

PDB Compounds: (E:) ca

SCOPe Domain Sequences for d6obhe1:

Sequence; same for both SEQRES and ATOM records:

>d6obhe1 a.73.1.1 (E:1-147) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalscgatpqdlncmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Timeline for d6obhe1:

• d6obhe1 first appeared in SCOPe 2.07