Lineage for d6j55g1 (6j55 G:2-87)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690341Species Acanthamoeba castellanii [TaxId:5755] [370308] (1 PDB entry)
  8. 2690348Domain d6j55g1: 6j55 G:2-87 [370357]
    Other proteins in same PDB: d6j55a2, d6j55a3, d6j55b2, d6j55b3, d6j55c2, d6j55c3, d6j55d2, d6j55d3, d6j55e2, d6j55f2, d6j55g2, d6j55h2, d6j55i2, d6j55j2, d6j55k2, d6j55l2, d6j55l3
    automated match to d2awpa1
    complexed with fe2

Details for d6j55g1

PDB Entry: 6j55 (more details), 2.33 Å

PDB Description: crystal structure of an iron superoxide dismutate (fesod) from a pathogenic acanthamoeba castellanii
PDB Compounds: (G:) superoxide dismutase

SCOPe Domain Sequences for d6j55g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j55g1 a.2.11.0 (G:2-87) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
lftlndpaylktglepaisaktldfhfnghhktylnktndlvkgtslenksledvilvak
ttnnaalfnnatqlwnhsffwdcmap

SCOPe Domain Coordinates for d6j55g1:

Click to download the PDB-style file with coordinates for d6j55g1.
(The format of our PDB-style files is described here.)

Timeline for d6j55g1: