Lineage for d6j55l2 (6j55 L:88-196)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2946001Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 2946002Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 2946299Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 2946300Protein automated matches [226860] (38 species)
    not a true protein
  7. 2946301Species Acanthamoeba castellanii [TaxId:5755] [370310] (1 PDB entry)
  8. 2946313Domain d6j55l2: 6j55 L:88-196 [370394]
    Other proteins in same PDB: d6j55a1, d6j55a3, d6j55b1, d6j55b3, d6j55c1, d6j55c3, d6j55d1, d6j55d3, d6j55e1, d6j55f1, d6j55g1, d6j55h1, d6j55i1, d6j55j1, d6j55k1, d6j55l1, d6j55l3
    automated match to d2awpa2
    complexed with fe2

Details for d6j55l2

PDB Entry: 6j55 (more details), 2.33 Å

PDB Description: crystal structure of an iron superoxide dismutate (fesod) from a pathogenic acanthamoeba castellanii
PDB Compounds: (L:) superoxide dismutase

SCOPe Domain Sequences for d6j55l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6j55l2 d.44.1.0 (L:88-196) automated matches {Acanthamoeba castellanii [TaxId: 5755]}
tnqtgqispeleklikesfgsvadfkkkftdsaianfgsgwtwlvningkleiqntsnae
spvtlrvtplltvdvwehayyldhqnrrpeylnkwwevvnwkfvdqqlk

SCOPe Domain Coordinates for d6j55l2:

Click to download the PDB-style file with coordinates for d6j55l2.
(The format of our PDB-style files is described here.)

Timeline for d6j55l2: