Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
Protein automated matches [226860] (38 species) not a true protein |
Species Acanthamoeba castellanii [TaxId:5755] [370310] (1 PDB entry) |
Domain d6j55d2: 6j55 D:88-197 [370317] Other proteins in same PDB: d6j55a1, d6j55a3, d6j55b1, d6j55b3, d6j55c1, d6j55c3, d6j55d1, d6j55d3, d6j55e1, d6j55f1, d6j55g1, d6j55h1, d6j55i1, d6j55j1, d6j55k1, d6j55l1, d6j55l3 automated match to d2awpa2 complexed with fe2 |
PDB Entry: 6j55 (more details), 2.33 Å
SCOPe Domain Sequences for d6j55d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j55d2 d.44.1.0 (D:88-197) automated matches {Acanthamoeba castellanii [TaxId: 5755]} tnqtgqispeleklikesfgsvadfkkkftdsaianfgsgwtwlvningkleiqntsnae spvtlrvtplltvdvwehayyldhqnrrpeylnkwwevvnwkfvdqqlkq
Timeline for d6j55d2:
View in 3D Domains from other chains: (mouse over for more information) d6j55a1, d6j55a2, d6j55a3, d6j55b1, d6j55b2, d6j55b3, d6j55c1, d6j55c2, d6j55c3, d6j55e1, d6j55e2, d6j55f1, d6j55f2, d6j55g1, d6j55g2, d6j55h1, d6j55h2, d6j55i1, d6j55i2, d6j55j1, d6j55j2, d6j55k1, d6j55k2, d6j55l1, d6j55l2, d6j55l3 |