Class a: All alpha proteins [46456] (290 folds) |
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) automatically mapped to Pfam PF00081 |
Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
Protein automated matches [226859] (39 species) not a true protein |
Species Acanthamoeba castellanii [TaxId:5755] [370308] (1 PDB entry) |
Domain d6j55d1: 6j55 D:1-87 [370316] Other proteins in same PDB: d6j55a2, d6j55a3, d6j55b2, d6j55b3, d6j55c2, d6j55c3, d6j55d2, d6j55d3, d6j55e2, d6j55f2, d6j55g2, d6j55h2, d6j55i2, d6j55j2, d6j55k2, d6j55l2, d6j55l3 automated match to d2awpa1 complexed with fe2 |
PDB Entry: 6j55 (more details), 2.33 Å
SCOPe Domain Sequences for d6j55d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j55d1 a.2.11.0 (D:1-87) automated matches {Acanthamoeba castellanii [TaxId: 5755]} mlftlndpaylktglepaisaktldfhfnghhktylnktndlvkgtslenksledvilva kttnnaalfnnatqlwnhsffwdcmap
Timeline for d6j55d1:
View in 3D Domains from other chains: (mouse over for more information) d6j55a1, d6j55a2, d6j55a3, d6j55b1, d6j55b2, d6j55b3, d6j55c1, d6j55c2, d6j55c3, d6j55e1, d6j55e2, d6j55f1, d6j55f2, d6j55g1, d6j55g2, d6j55h1, d6j55h2, d6j55i1, d6j55i2, d6j55j1, d6j55j2, d6j55k1, d6j55k2, d6j55l1, d6j55l2, d6j55l3 |