Lineage for d2awpa1 (2awp A:1-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690500Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [225014] (1 PDB entry)
  8. 2690501Domain d2awpa1: 2awp A:1-83 [203505]
    Other proteins in same PDB: d2awpa2, d2awpb2
    automated match to d1ma1a1
    complexed with cl, unx

Details for d2awpa1

PDB Entry: 2awp (more details), 2 Å

PDB Description: Crystal structure of Plasmodium knowlesi structure of Iron Super-Oxide Dismutase
PDB Compounds: (A:) Iron Super-Oxide Dismutase

SCOPe Domain Sequences for d2awpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2awpa1 a.2.11.0 (A:1-83) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
maiilpklkyalnalsphiseetlnfhynkhhagyvnklnglikdtpfatkslveimkes
tgaifnnaaqiwnhsfywdsmgp

SCOPe Domain Coordinates for d2awpa1:

Click to download the PDB-style file with coordinates for d2awpa1.
(The format of our PDB-style files is described here.)

Timeline for d2awpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2awpa2