SCOPe 2.08: Domain d2awpb2: 2awp B:84-196

Lineage for d2awpb2 (2awp B:84-196)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Malaria parasite (Plasmodium knowlesi) [TaxId:5850] [225015] (1 PDB entry)

8. Domain d2awpb2: 2awp B:84-196 [203508]
   Other proteins in same PDB: d2awpa1, d2awpb1
   automated match to d1ma1a2
   complexed with cl, unx

Details for d2awpb2

PDB Entry: 2awp, 2 Å

PDB Description: Crystal structure of Plasmodium knowlesi structure of Iron Super-Oxide Dismutase

PDB Compounds: (B:) Iron Super-Oxide Dismutase

SCOPe Domain Sequences for d2awpb2:

Sequence; same for both SEQRES and ATOM records:

>d2awpb2 d.44.1.0 (B:84-196) automated matches {Malaria parasite (Plasmodium knowlesi) [TaxId: 5850]}
ncggephgeikekiqedfgsfnnfknefsnvlcghfgsgwgwlvlnnnnklvilqthdag
npikdntgipiltcdiwehayyidyrndrpsyvkawwnlvnwnfanenlkkal

Timeline for d2awpb2:

• d2awpb2 first appeared in SCOPe 2.03
  
• d2awpb2 appears in SCOPe 2.07