Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.3: GABARAP-like [54253] (4 proteins) intracellular membrane trafficking and fusion proteins automatically mapped to Pfam PF02991 |
Protein automated matches [190358] (6 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries) |
Domain d6h8ca1: 6h8c A:3-116 [368390] Other proteins in same PDB: d6h8ca2 automated match to d1eo6b_ |
PDB Entry: 6h8c (more details)
SCOPe Domain Sequences for d6h8ca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h8ca1 d.15.1.3 (A:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]} wmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqfmw iirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfg
Timeline for d6h8ca1: