Lineage for d6h8ca1 (6h8c A:3-116)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932720Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2932757Protein automated matches [190358] (6 species)
    not a true protein
  7. 2932770Species Human (Homo sapiens) [TaxId:9606] [187279] (33 PDB entries)
  8. 2932842Domain d6h8ca1: 6h8c A:3-116 [368390]
    Other proteins in same PDB: d6h8ca2
    automated match to d1eo6b_

Details for d6h8ca1

PDB Entry: 6h8c (more details)

PDB Description: structure of the human gabarapl2 protein in complex with the uba5 lir motif
PDB Compounds: (A:) gamma-aminobutyric acid receptor-associated protein-like 2

SCOPe Domain Sequences for d6h8ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h8ca1 d.15.1.3 (A:3-116) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqfmw
iirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfg

SCOPe Domain Coordinates for d6h8ca1:

Click to download the PDB-style file with coordinates for d6h8ca1.
(The format of our PDB-style files is described here.)

Timeline for d6h8ca1:

  • d6h8ca1 first appeared in SCOPe 2.07, called d6h8ca_