Lineage for d6h8ca_ (6h8c A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2539843Family d.15.1.3: GABARAP-like [54253] (4 proteins)
    intracellular membrane trafficking and fusion proteins
    automatically mapped to Pfam PF02991
  6. 2539876Protein automated matches [190358] (6 species)
    not a true protein
  7. 2539889Species Human (Homo sapiens) [TaxId:9606] [187279] (32 PDB entries)
  8. 2539961Domain d6h8ca_: 6h8c A: [368390]
    automated match to d1eo6b_

Details for d6h8ca_

PDB Entry: 6h8c (more details)

PDB Description: structure of the human gabarapl2 protein in complex with the uba5 lir motif
PDB Compounds: (A:) gamma-aminobutyric acid receptor-associated protein-like 2

SCOPe Domain Sequences for d6h8ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6h8ca_ d.15.1.3 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfg

SCOPe Domain Coordinates for d6h8ca_:

Click to download the PDB-style file with coordinates for d6h8ca_.
(The format of our PDB-style files is described here.)

Timeline for d6h8ca_:

  • d6h8ca_ is new in SCOPe 2.07-stable
  • d6h8ca_ appears in the current release, SCOPe 2.08, called d6h8ca1