PDB entry 6h8c

View 6h8c on RCSB PDB site
Description: Structure of the human GABARAPL2 protein in complex with the UBA5 LIR motif
Class: signaling protein
Keywords: GABARAPL2, UBA5 LIR motif, protein complex, SIGNALING PROTEIN
Deposited on 2018-08-02, released 2019-05-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-29, with a file datestamp of 2020-01-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: gamma-aminobutyric acid receptor-associated protein-like 2
  Species: Homo sapiens [TaxId:9606]
  Gene: GABARAPL2, FLC3A, GEF2
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60520 (2-115)
    • initiating methionine (0)
    • expression tag (1)
  Domains in SCOPe 2.08: d6h8ca1, d6h8ca2
• Chain 'B':
  Compound: Ubiquitin-like modifier-activating enzyme 5
  Species: Homo sapiens [TaxId:9606]
  Gene: UBA5, UBE1DC1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9GZZ9 (3-18)
    • expression tag (0-2)

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >6h8cA (A:)
  mgwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
  mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfg
  

  
  
• Chain 'B':
  No sequence available.