Lineage for d1eo6b_ (1eo6 B:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) 
Family d.15.1.3: GABARAP-like [54253] (4 proteins)
intracellular membrane trafficking and fusion proteins
automatically mapped to Pfam PF02991
Protein Golgi-associated ATPase enhancer of 16 kD, Gate-16 [54254] (1 species) Species Cow (Bos taurus) [TaxId:9913] [54255] (1 PDB entry) 
Domain d1eo6b_: 1eo6 B: [37610]
Details for d1eo6b_
PDB Entry: 1eo6 (more details), 1.8 Å
PDB Description: crystal structure of gate-16
PDB Compounds: (B:) golgi-associated ATPase enhancer of 16 kdSCOPe Domain Sequences for d1eo6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eo6b_ d.15.1.3 (B:) Golgi-associated ATPase enhancer of 16 kD, Gate-16 {Cow (Bos taurus) [TaxId: 9913]}
mkwmfkedhslehrcvesakirakypdrvpvivekvsgsqivdidkrkylvpsditvaqf
mwiirkriqlpsekaiflfvdktvpqssltmgqlyekekdedgflyvaysgentfgf
SCOPe Domain Coordinates for d1eo6b_:
Click to download the PDB-style file with coordinates for d1eo6b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1eo6b_:
- d1eo6b_ first appeared (with stable ids) in SCOP 1.55
- d1eo6b_ appears in SCOPe 2.07
View in 3D
