Lineage for d6dfva2 (6dfv A:118-193)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2363807Domain d6dfva2: 6dfv A:118-193 [367723]
    Other proteins in same PDB: d6dfva1, d6dfvb1, d6dfvc1, d6dfvd1
    automated match to d2f54d2
    complexed with edo

Details for d6dfva2

PDB Entry: 6dfv (more details), 1.71 Å

PDB Description: mouse diabetogenic tcr 8f10
PDB Compounds: (A:) TcR alpha chain

SCOPe Domain Sequences for d6dfva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfva2 b.1.1.2 (A:118-193) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanaf

SCOPe Domain Coordinates for d6dfva2:

Click to download the PDB-style file with coordinates for d6dfva2.
(The format of our PDB-style files is described here.)

Timeline for d6dfva2: