SCOPe 2.07: Domain d6dfvb2: 6dfv B:114-241

Lineage for d6dfvb2 (6dfv B:114-241)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (17 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
Domain d6dfvb2: 6dfv B:114-241 [367837]
Other proteins in same PDB: d6dfva1, d6dfvb1, d6dfvc1, d6dfvd1
automated match to d3of6b2
complexed with edo

Details for d6dfvb2

PDB Entry: 6dfv (more details), 1.71 Å

PDB Description: mouse diabetogenic tcr 8f10

PDB Compounds: (B:) TCR beta chain

SCOPe Domain Sequences for d6dfvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6dfvb2 b.1.1.2 (B:114-241) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d6dfvb2:

Click to download the PDB-style file with coordinates for d6dfvb2.
(The format of our PDB-style files is described here.)

Timeline for d6dfvb2: