Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d6dfvb1: 6dfv B:2-113 [367836] Other proteins in same PDB: d6dfva2, d6dfvb2, d6dfvc2, d6dfvd2 automated match to d3of6c1 complexed with edo |
PDB Entry: 6dfv (more details), 1.71 Å
SCOPe Domain Sequences for d6dfvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6dfvb1 b.1.1.0 (B:2-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtggkvtlscdqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqkefslilelatpsqtsvyfcasgglggdeqyfgpgtrltvled
Timeline for d6dfvb1: