Lineage for d6flbg_ (6flb G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766213Species Dengue virus 2 [TaxId:11060] [268950] (4 PDB entries)
  8. 2766214Domain d6flbg_: 6flb G: [359242]
    Other proteins in same PDB: d6flbh1, d6flbh2, d6flbl1, d6flbl2
    automated match to d3egpa_
    complexed with cl, gol, po4

Details for d6flbg_

PDB Entry: 6flb (more details), 2.2 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 2
PDB Compounds: (G:) Domain III of Dengue virus 2

SCOPe Domain Sequences for d6flbg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6flbg_ b.1.18.0 (G:) automated matches {Dengue virus 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgss

SCOPe Domain Coordinates for d6flbg_:

Click to download the PDB-style file with coordinates for d6flbg_.
(The format of our PDB-style files is described here.)

Timeline for d6flbg_: