Lineage for d6flbh1 (6flb H:9-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744745Domain d6flbh1: 6flb H:9-218 [411131]
    Other proteins in same PDB: d6flbg_, d6flbh2, d6flbl1, d6flbl2
    automated match to d6shgh_
    complexed with cl, gol, po4

Details for d6flbh1

PDB Entry: 6flb (more details), 2.2 Å

PDB Description: 3h5 fab bound to ediii of denv 2 xtal form 2
PDB Compounds: (H:) Heavy chain of 3H5 Fab

SCOPe Domain Sequences for d6flbh1:

Sequence, based on SEQRES records: (download)

>d6flbh1 b.1.1.1 (H:9-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aevarpgasvklsckasgytftsywlqwvkqrpgqglewigaiwpgdddtryaqkfqgka
tmtadkssstayiqlsnlasedsavyycarkggfamdywgqgtsvtvssakttppsvypl
apgsgaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvp
sstwpsetvtcnvahpasstkvdkkieprd

Sequence, based on observed residues (ATOM records): (download)

>d6flbh1 b.1.1.1 (H:9-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aevarpgasvklsckasgytftsywlqwvkqrpgqglewigaiwpgdddtryaqkfqgka
tmtadkssstayiqlsnlasedsavyycarkggfamdywgqgtsvtvssakttppsvypl
apgnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytlsssvtvpsstwp
setvtcnvahpasstkvdkkieprd

SCOPe Domain Coordinates for d6flbh1:

Click to download the PDB-style file with coordinates for d6flbh1.
(The format of our PDB-style files is described here.)

Timeline for d6flbh1:

  • d6flbh1 is new in SCOPe 2.08-stable