Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (24 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (72 species) not a true protein |
Species Dengue virus 2 [TaxId:11060] [268950] (4 PDB entries) |
Domain d6flbg_: 6flb G: [359242] Other proteins in same PDB: d6flbl1, d6flbl2 automated match to d3egpa_ complexed with cl, gol, po4 |
PDB Entry: 6flb (more details), 2.2 Å
SCOPe Domain Sequences for d6flbg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6flbg_ b.1.18.0 (G:) automated matches {Dengue virus 2 [TaxId: 11060]} sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgss
Timeline for d6flbg_: