Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Dengue virus 1 [TaxId:11053] [311284] (2 PDB entries) |
Domain d3egpa_: 3egp A: [305263] automated match to d2h0pa_ |
PDB Entry: 3egp (more details), 2.4 Å
SCOPe Domain Sequences for d3egpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3egpa_ b.1.18.0 (A:) automated matches {Dengue virus 1 [TaxId: 11053]} msyvmctgsfklekevaetqhgtvlvqvkyegtdapckipfstqdekgatqngrlitanp ivtdkekpvnieaeppfgesyivvgagekalklswfkkgssi
Timeline for d3egpa_: