PDB entry 6flb

View 6flb on RCSB PDB site
Description: 3H5 Fab bound to EDIII of DenV 2 Xtal form 2
Class: viral protein
Keywords: Dengue virus, antibody, macromolecular complex, VIRAL PROTEIN
Deposited on 2018-01-25, released 2018-10-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-10-24, with a file datestamp of 2018-10-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: Domain III of Dengue virus 2
    Species: Dengue virus 2 [TaxId:11060]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6flbg_
  • Chain 'H':
    Compound: Heavy chain of 3H5 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FLB (0-End)
  • Chain 'L':
    Compound: Light chain of 3H5 Fab
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 6FLB (0-End)
    Domains in SCOPe 2.07: d6flbl1, d6flbl2
  • Heterogens: PO4, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6flbG (G:)
    sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
    vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkgss
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >6flbL (L:)
    nivmtqsptslavslgqratiscrasesvdsfgksfmhfyqqkpgqppkllihlasnles
    gvparftgrgsrtdftltidpveaddaatyycqqnnevpftfgsgtklevkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >6flbL (L:)
    nivmtqsptslavslgqratiscrasesvdsfgksfmhfyqqkpgqppkllihlasnles
    gvparftgrgsrtdftltidpveaddaatyycqqnnevpftfgsgtklevkradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrn