Lineage for d5xjta_ (5xjt A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2786772Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2786953Protein D1 core SNRNP protein [50184] (4 species)
  7. 2786954Species Human (Homo sapiens) [TaxId:9606] [50185] (10 PDB entries)
  8. 2786980Domain d5xjta_: 5xjt A: [354361]
    Other proteins in same PDB: d5xjtb_, d5xjte_, d5xjtf_, d5xjtg_
    automated match to d4f7ua_

Details for d5xjta_

PDB Entry: 5xjt (more details), 2.92 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1(1-82)/d2.r61a/f/e/g from human
PDB Compounds: (A:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d5xjta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjta_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir
gnniryfilpdslpldtllv

SCOPe Domain Coordinates for d5xjta_:

Click to download the PDB-style file with coordinates for d5xjta_.
(The format of our PDB-style files is described here.)

Timeline for d5xjta_: