![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins) forms homo and heteroheptameric ring structures Pfam PF01423 |
![]() | Protein D1 core SNRNP protein [50184] (4 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50185] (10 PDB entries) |
![]() | Domain d5xjta_: 5xjt A: [354361] Other proteins in same PDB: d5xjtb_, d5xjte_, d5xjtf_, d5xjtg_ automated match to d4f7ua_ |
PDB Entry: 5xjt (more details), 2.92 Å
SCOPe Domain Sequences for d5xjta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xjta_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} klvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsir gnniryfilpdslpldtllv
Timeline for d5xjta_:
![]() Domains from other chains: (mouse over for more information) d5xjtb_, d5xjte_, d5xjtf_, d5xjtg_ |