![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
![]() | Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) ![]() |
![]() | Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
![]() | Protein automated matches [190914] (14 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries) |
![]() | Domain d5xjte_: 5xjt E: [354320] Other proteins in same PDB: d5xjta_, d5xjtb_ automated match to d4f7uh_ |
PDB Entry: 5xjt (more details), 2.92 Å
SCOPe Domain Sequences for d5xjte_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5xjte_ b.38.1.0 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qpinlifrylqnrsriqvwlyeqvnmriegciigfdeymnlvlddaeeihsktksrkqlg rimlkgdnitllqsv
Timeline for d5xjte_:
![]() Domains from other chains: (mouse over for more information) d5xjta_, d5xjtb_, d5xjtf_, d5xjtg_ |