Lineage for d5xjtg_ (5xjt G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787534Species Human (Homo sapiens) [TaxId:9606] [196227] (10 PDB entries)
  8. 2787601Domain d5xjtg_: 5xjt G: [354307]
    Other proteins in same PDB: d5xjta_, d5xjtb_
    automated match to d3jb9j_

Details for d5xjtg_

PDB Entry: 5xjt (more details), 2.92 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1(1-82)/d2.r61a/f/e/g from human
PDB Compounds: (G:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d5xjtg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5xjtg_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkfmdkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgnsiim
lea

SCOPe Domain Coordinates for d5xjtg_:

Click to download the PDB-style file with coordinates for d5xjtg_.
(The format of our PDB-style files is described here.)

Timeline for d5xjtg_: