SCOPe 2.08: Domain d5xjtb_: 5xjt B:

Lineage for d5xjtb_ (5xjt B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein D2 core SNRNP protein [50186] (3 species)
   3jb9 chains G and l are D2 subunits from fission yeast; not included because sids are not case sensitive

7. Species Human (Homo sapiens) [TaxId:9606] [50187] (10 PDB entries)

8. Domain d5xjtb_: 5xjt B: [354428]
   Other proteins in same PDB: d5xjta_, d5xjte_, d5xjtf_, d5xjtg_
   automated match to d1vu2b_

Details for d5xjtb_

PDB Entry: 5xjt, 2.92 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1(1-82)/d2.r61a/f/e/g from human

PDB Compounds: (B:) Small nuclear ribonucleoprotein Sm D2

SCOPe Domain Sequences for d5xjtb_:

Sequence, based on SEQRES records:

>d5xjtb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
qkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdahcnmvlenvkemwte
vpksgkgkkkskpvnkdryiskmflrgdsvivvlrnpliag

Sequence, based on observed residues (ATOM records):

>d5xjtb_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
qkreeeefntgplsvltqsvknntqvlincrnnkkllgrvkafdahcnmvlenvkemwte
vkpvnkdryiskmflrgdsvivvlrnpliag

Timeline for d5xjtb_:

• d5xjtb_ first appeared in SCOPe 2.07