Lineage for d6ftle2 (6ftl E:154-484)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2838499Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (2 families) (S)
    automatically mapped to Pfam PF00016
  5. 2838500Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (2 proteins)
    N-terminal domain is alpha+beta
  6. 2838730Protein automated matches [226984] (16 species)
    not a true protein
  7. 2838927Species Skeletonema marinoi [TaxId:267567] [353916] (1 PDB entry)
  8. 2838930Domain d6ftle2: 6ftl E:154-484 [353934]
    Other proteins in same PDB: d6ftla1, d6ftlc1, d6ftle1, d6ftlg1, d6ftli_, d6ftlj_, d6ftlk_, d6ftll_
    automated match to d1bwva1
    complexed with cap, edo, mg

Details for d6ftle2

PDB Entry: 6ftl (more details), 2.6 Å

PDB Description: rubisco from skeletonema marinoi
PDB Compounds: (E:) ribulose bisphosphate carboxylase large chain

SCOPe Domain Sequences for d6ftle2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ftle2 c.1.14.1 (E:154-484) automated matches {Skeletonema marinoi [TaxId: 267567]}
gpatgiivererlnkygtpllgatvkpklglsgknygrvvyeglxggldflkddeninsq
pfmrwrerflncmeginrasaatgevkgsylnitaatmeevykraeyakavgsivvmidl
vmgytaiqsiaywarendmllhlhragnstyarqknhginfrvickwmrmsgvdhihagt
vvgklegdplmikgfydilrltelevnlpfgiffemdwaslrrcmpvasggihcgqmhql
ihylgddvvlqfgggtighpdgiqagatanrvalesmvlarnegvdyfdqqvgpqilrda
aktcgplqtaldlwkdisfdytstdtadfae

SCOPe Domain Coordinates for d6ftle2:

Click to download the PDB-style file with coordinates for d6ftle2.
(The format of our PDB-style files is described here.)

Timeline for d6ftle2: